Protein Info for CCNA_01995 in Caulobacter crescentus NA1000

Annotation: phosphatidate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 31 to 57 (27 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 121 to 138 (18 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 210 to 231 (22 residues), see Phobius details amino acids 261 to 275 (15 residues), see Phobius details PF01148: CTP_transf_1" amino acids 23 to 271 (249 residues), 230.3 bits, see alignment E=2e-72

Best Hits

KEGG orthology group: K00981, phosphatidate cytidylyltransferase [EC: 2.7.7.41] (inferred from 100% identity to ccs:CCNA_01995)

Predicted SEED Role

"Phosphatidate cytidylyltransferase (EC 2.7.7.41)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.7.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7X9 at UniProt or InterPro

Protein Sequence (281 amino acids)

>CCNA_01995 phosphatidate cytidylyltransferase (Caulobacter crescentus NA1000)
MEGSLPMTSPSPAKRFNWGNLRTRVVSATVLVPTVVAAVWLGGYWFMALSLVCVGLLARE
WGRISAPKAPNAVGAVVGVFCGIAVVAAFLQQFLVAWAVVLVGSFLAGLIARGAVERRAD
AAYGVVYIAPAVIAMVWVRSLDDGLWWTLLLFVVTWFADIFAYVTGSILKGPKLWPRISP
NKTWAGFVGGLAAATIGAVVVASLAKLDLIWQAAALIGLLGGLATMAGDLWESMLKRRFG
VKDSGDLIPGHGGLLDRVDGLMFAAIVIAAVRLVDQIGWGH