Protein Info for CCNA_01992 in Caulobacter crescentus NA1000

Annotation: beta-barrel assembly machine (BAM) protein BamA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 787 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details TIGR03303: outer membrane protein assembly complex, YaeT protein" amino acids 43 to 786 (744 residues), 807.1 bits, see alignment E=8.4e-247 PF07244: POTRA" amino acids 44 to 108 (65 residues), 22.7 bits, see alignment E=2.1e-08 amino acids 110 to 187 (78 residues), 66.4 bits, see alignment E=4.6e-22 amino acids 195 to 278 (84 residues), 57.5 bits, see alignment E=2.8e-19 amino acids 281 to 360 (80 residues), 46.4 bits, see alignment E=7.8e-16 amino acids 363 to 435 (73 residues), 49.4 bits, see alignment E=9.3e-17 PF01103: Omp85" amino acids 463 to 786 (324 residues), 279.3 bits, see alignment E=8.1e-87

Best Hits

KEGG orthology group: K07277, outer membrane protein (inferred from 100% identity to ccs:CCNA_01992)

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9L0 at UniProt or InterPro

Protein Sequence (787 amino acids)

>CCNA_01992 beta-barrel assembly machine (BAM) protein BamA (Caulobacter crescentus NA1000)
MIGHMNKLRAQSAAFATGMALLLGSTALVAPQQAFAQAAQTGVVQRILVQGNERIEQGTV
LSYLPIQPGDTVDSQRLDLALKTLARTDLFADVKIEMLGGDLVVKVVENPIINQVVFEGN
SSLKEDKLKDEVQIRPRGIFTRAKVQADVQRIIELYRRSGRISATVTPKVVELPQKRVDL
VFEINEGAKSGVLGINFLGNAEYSDNDLRDVIVTKESRWYKILTSNDNYDPDRIEYDREQ
LRKHYRNRGYFDFRVISSVAELAPDKNGFAVTYTLEEGPKYKFGKITVETELKKLDGNLL
AQILPVRTGQLYEDERIEQATDALTFAAGAAGFAFVDVRPRYVPNRETKTVDVVFQVREG
PRVYVDRIDIVGNTRTLDYVLRRELEVAEGDAYNRVLVDRSKNNMRRLGFFKEVEIEDAP
GSAPDRTSLRVKVEEQPTGELSFSAGYSSIDKLVLDVGITERNFRGRGQNLRARASVGSL
RQQIDFGFSEPRFLGRNLVAGVNLYTFRYDLSEFAAYDTKSVGGDVRFGFPLTNDSSMSL
RYTVRQDEVSVADSLCASGSVSQILCLQRGAYITSLIGYGLRIDKRNDPINPTRGWFADL
NQDLAGVGGDVKYLKTEADAGWYWGFTKDLVFSATGSFGYIEGWGGDNVRINDRFYRGGT
SFRGFEIAGIGPRDISSSFNSMGAKLYAISTFELTVPTFLPEQYGIKAALFSDVGTAGLL
DDVDRQRSPGVFDPNIKDNLGLRASAGISIDWKSPMGPIRFDISRILSKEDYDRTETFRF
STSTRFQ