Protein Info for CCNA_01967 in Caulobacter crescentus NA1000

Annotation: hypothetical protein with pentapeptide repeats

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00805: Pentapeptide" amino acids 41 to 78 (38 residues), 24.7 bits, see alignment 2.1e-09 amino acids 57 to 87 (31 residues), 22.9 bits, see alignment 7.8e-09 amino acids 73 to 108 (36 residues), 26.4 bits, see alignment 6.1e-10 amino acids 82 to 118 (37 residues), 36.6 bits, see alignment 4.1e-13 amino acids 101 to 136 (36 residues), 39.3 bits, see alignment 5.8e-14 amino acids 111 to 136 (26 residues), 27.8 bits, see alignment 2.2e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_1890)

Predicted SEED Role

"Pentapeptide repeat family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9J2 at UniProt or InterPro

Protein Sequence (165 amino acids)

>CCNA_01967 hypothetical protein with pentapeptide repeats (Caulobacter crescentus NA1000)
MKPIALLAAALGVALSVATPVSAQNAGQIAAVRNGANCPRCNLFQADLSNLTLKGKNLAG
ARLRQADLSTAVMNRTRFAGGDLRDVNAYGAVMTGASFARADLTNASFVGAYLQGANFAG
ARLSGVNFSGAEMDRATGLKQSQLSQACGDDSTLLPRGLSIPRCR