Protein Info for CCNA_01960 in Caulobacter crescentus NA1000

Annotation: acetyl-CoA carboxylase biotin carboxyl carrier protein subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00531: acetyl-CoA carboxylase, biotin carboxyl carrier protein
  • amino acids 17 to 170 (154 residues), 152.8 bits, E=5.1e-49
• PF00364: Biotin_lipoyl
  • amino acids 96 to 169 (74 residues), 79.9 bits, E=1e-26

Best Hits

Swiss-Prot: 48% identical to BCCP_HAEIN: Biotin carboxyl carrier protein of acetyl-CoA carboxylase (accB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02160, acetyl-CoA carboxylase biotin carboxyl carrier protein (inferred from 100% identity to ccr:CC_1883)

MetaCyc: 46% identical to biotin carboxyl carrier protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Biotin carboxyl carrier protein of acetyl-CoA carboxylase" in subsystem Fatty Acid Biosynthesis FASII

MetaCyc Pathways

• biotin-carboxyl carrier protein assembly (4/4 steps found)
• 3-hydroxypropanoate cycle (9/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (12/18 steps found)
• glyoxylate assimilation (8/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)

Sequence Analysis Tools

See A0A0H3C9I8 at UniProt or InterPro

Protein Sequence (170 amino acids)

>CCNA_01960 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit (Caulobacter crescentus NA1000)
MSNPKAPADPVEAPAIDARLVRKLADILKDTGLSEIEVEHAGLKIRVARELTAAPVNYVQ
AAAPAYAPAPAAASAPVAAAPAPAVEAAPAAVRGDAVKSPMVGTAYLSPQPGADAFVKVG
DTVAAGQTLLIVEAMKTMNPIAAPKAGKIVEILVEDAQPVEFGEPLVVIE