Protein Info for CCNA_01942 in Caulobacter crescentus NA1000
Annotation: Rrf2 family protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 49% identical to ISCR_XENNA: HTH-type transcriptional regulator IscR (iscR) from Xenorhabdus nematophila (strain ATCC 19061 / DSM 3370 / LMG 1036 / NCIB 9965 / AN6)
KEGG orthology group: K13643, Rrf2 family transcriptional regulator, iron-sulfur cluster assembly transcription factor (inferred from 100% identity to ccr:CC_1866)Predicted SEED Role
"Iron-sulfur cluster regulator IscR" in subsystem Rrf2 family transcriptional regulators
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0H3C7T4 at UniProt or InterPro
Protein Sequence (158 amino acids)
>CCNA_01942 Rrf2 family protein (Caulobacter crescentus NA1000) MRLSTKGRYAVMAMTDLAKRQDESDGRAVALAEIAARQQISLSYLEQLFARLRRKGLVIS ARGPGGGYRLAKASDETFIADIVLAVDEPLRATRCNFTKGQAKGCMAGGERCMTHNLWEE MGRQIHGYLASVSVADVLAGELRPQGSMMGRPMEIAAE