Protein Info for CCNA_01916 in Caulobacter crescentus NA1000

Annotation: ribonuclease BN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 53 to 80 (28 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 161 to 189 (29 residues), see Phobius details amino acids 209 to 227 (19 residues), see Phobius details amino acids 239 to 259 (21 residues), see Phobius details amino acids 271 to 296 (26 residues), see Phobius details PF03631: Virul_fac_BrkB" amino acids 50 to 301 (252 residues), 155.3 bits, see alignment E=1.3e-49

Best Hits

KEGG orthology group: K07058, membrane protein (inferred from 100% identity to ccs:CCNA_01916)

Predicted SEED Role

"Ribonuclease BN (EC 3.1.-.-)" in subsystem LMPTP YfkJ cluster or tRNA processing (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAM7 at UniProt or InterPro

Protein Sequence (328 amino acids)

>CCNA_01916 ribonuclease BN (Caulobacter crescentus NA1000)
MTSQGRAAMVRRMHDPQQPIRWRDLDLDPTHWVREILRVLGLALSRLWGRDVMLYVGGVS
FFALLAVFPGLAILIGLYSLFLTPETAAWQAVKLAELIPSGARSIVQDELSRLAHAPGQT
ISLQSGVVLIVGAYAAHRGFKALLAGLSFIHDEENQRGFLGFNLMALLVLMAAFGLLFIM
SGIFLTLRLLGTALELRPLAGVSWIQSEWTWASFGIVVGMSLVYRYAMSRQIVGWRASIA
GGVAAAALCVFMSWASAFYVEKVVHLGATYGSVSAVIIFLIWLSWSVNAIFFGGALATEV
EIALDERPRALLEGPRPIALKAPSESES