Protein Info for CCNA_01914 in Caulobacter crescentus NA1000

Annotation: 16S rRNA m(2)G 1207 methyltransferase RsmC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 PF05175: MTS" amino acids 138 to 298 (161 residues), 164.1 bits, see alignment E=4.9e-52 PF01170: UPF0020" amino acids 190 to 282 (93 residues), 24 bits, see alignment E=5.9e-09

Best Hits

KEGG orthology group: K00564, ribosomal RNA small subunit methyltransferase C [EC: 2.1.1.172] (inferred from 100% identity to ccs:CCNA_01914)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase C (EC 2.1.1.52)" (EC 2.1.1.52)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.172 or 2.1.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C929 at UniProt or InterPro

Protein Sequence (302 amino acids)

>CCNA_01914 16S rRNA m(2)G 1207 methyltransferase RsmC (Caulobacter crescentus NA1000)
MSANRTALYGLPDHDLAPCASDAVQLSPLIVGSTDLATVADETFDAVTARAPAGAVERRY
VLAHALRTLSPGGRLTVFAPKDRGGLRLKKELQALGCEVGESARRHNRICVCLRPSLIPG
LEDALKAGAPRRIAENGLWTQPGVFSWDRLDAGTNALLQVLPAFSGVGADFGSGIGLLAL
NVLASPKVTKLTLVELDHRAVEVSRRNVTDPRGEIVWVDARQTGLKDLDFVVSNPPFHEG
GGEDKALGQAFIRAAAEALRKGGSLWIVANRHLPYEAILGESFSKVRLVGEGGGYKVFEA
KK