Protein Info for CCNA_01908 in Caulobacter crescentus NA1000

Annotation: ABC-type transporter, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 82 to 105 (24 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 201 to 224 (24 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 93 to 260 (168 residues), 62.9 bits, see alignment E=1.7e-21

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to ccs:CCNA_01908)

Predicted SEED Role

"Urea carboxylase-related ABC transporter, permease protein" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8H4 at UniProt or InterPro

Protein Sequence (271 amino acids)

>CCNA_01908 ABC-type transporter, permease component (Caulobacter crescentus NA1000)
MRLLNIRPRGGLAVMLGAVPLLAAGLLYLMASQARHAENPRDKLLPTPEAMAEAVQLMAR
VDPLTGHAPLLVDTLASLERMGLALAIATAVSLLLGLSLGLLPLLRAKFGPLVAGIAVIP
PIAVLPILFIVFGLGETAKIALIVFGVAPVMVRDLAAHVAAIPEEQLVKAQTLGSSTWQL
ALRVALPQAMPRLIDSLRLSLCPAWVYLISAEAIAADVGLGYRIFLVRRYLSMDIILPYV
AWISLLAVIMDVTLRLISRRAYPWAYPERGR