Protein Info for CCNA_01903 in Caulobacter crescentus NA1000

Annotation: urea carboxylase-associated protein 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03425: urea carboxylase-associated protein 2
  • amino acids 50 to 277 (228 residues), 297.8 bits, E=2.1e-93
• PF09347: DUF1989
  • amino acids 54 to 222 (169 residues), 180.2 bits, E=1.4e-57

Best Hits

KEGG orthology group: K09967, hypothetical protein (inferred from 100% identity to ccs:CCNA_01903)

Predicted SEED Role

"Urea carboxylase-related aminomethyltransferase (EC 2.1.2.10)" in subsystem Urea decomposition (EC 2.1.2.10)

MetaCyc Pathways

• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Nitrogen metabolism
• One carbon pool by folate

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.10

Use Curated BLAST to search for 2.1.2.10

Sequence Analysis Tools

See A0A0H3C8G8 at UniProt or InterPro

Protein Sequence (279 amino acids)

>CCNA_01903 urea carboxylase-associated protein 2 (Caulobacter crescentus NA1000)
MSDAAQSHTATPYAAQAHARAQAGTRVESMPTVPAFAAVDLPSGVAAADVVWDETIAPGG
YASRRLSRGARLRLTDLRGDAAVSLLVFNAEQPVERLNIADTLKVQWNGYLGQGRLLLSD
MGRVLASLVEDTAGAHDAFCGASNQASNTRKYGDGFNHGDHPNARDRFSLGVAKFGLGRK
DIHPCLNLFKEVRIGQGGETVVDVGPYPPGRFVTLRAEMALIVVLANCPHVLDPRPDYAV
TPVRATAWRGPVTPESDPIRNATPEGLRAFLNVEDYFSR