Protein Info for CCNA_01902 in Caulobacter crescentus NA1000

Annotation: nickel-responsive regulator NikR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF01402: RHH_1" amino acids 13 to 51 (39 residues), 33.3 bits, see alignment E=3.3e-12 PF08753: NikR_C" amino acids 63 to 139 (77 residues), 72 bits, see alignment E=3.8e-24

Best Hits

Swiss-Prot: 36% identical to NIKR_PYRHO: Putative nickel-responsive regulator (PH0601) from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

KEGG orthology group: K07722, CopG family transcriptional regulator, nickel-responsive regulator (inferred from 100% identity to ccs:CCNA_01902)

Predicted SEED Role

"Nickel responsive regulator NikR" in subsystem Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7P4 at UniProt or InterPro

Protein Sequence (162 amino acids)

>CCNA_01902 nickel-responsive regulator NikR (Caulobacter crescentus NA1000)
MLDMEITSSNLARLSISLPAELMVQLDAMVAERGLPSRSQMIAELIRHELAEHSGERPDA
MLAGTITLIYRAESGRVRHALAQTQLGYVKEVISAQNVFLEDDQAMEVLLVQGPAERLQQ
LCDALRKVRGVQQIKLVTTTALLPPLHFHGDDAPFDGESTPP