Protein Info for CCNA_01895 in Caulobacter crescentus NA1000

Annotation: transporter, major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 transmembrane" amino acids 50 to 73 (24 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details amino acids 258 to 281 (24 residues), see Phobius details amino acids 304 to 325 (22 residues), see Phobius details amino acids 346 to 362 (17 residues), see Phobius details amino acids 368 to 392 (25 residues), see Phobius details amino acids 403 to 425 (23 residues), see Phobius details amino acids 438 to 461 (24 residues), see Phobius details PF07690: MFS_1" amino acids 55 to 419 (365 residues), 157 bits, see alignment E=6.3e-50

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_1819)

Predicted SEED Role

"FIG00481482: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9D2 at UniProt or InterPro

Protein Sequence (479 amino acids)

>CCNA_01895 transporter, major facilitator superfamily (Caulobacter crescentus NA1000)
MHPGGVAPRAGPRRRLAFDRKTIRERDMPDQNLTELEPPPVAWSDRYRRYALGLLMLIYA
LNMLDRQIITILAEPMKAELNLADWQIGAVSGLAFALFYSAVGLPMARFADRGDRVRLIA
ISLAVWSAFTAVCGLARTFPQLILARIGVGIGEAGCTPAAHSLITEFTPRAKLASALAFY
SLGIPLGSLLGLAVGGLLVDAMGWRAAFIIAGLPGIGVAVIASLTLREPRRLRPKAERAP
GQTTSLAAALAELKQKPAFWLIALAAALTSFSYYGQSAFFGSVFLRNHGPVLTQLGEDLG
LGPAGLAGLALGLAIGVSAGAGTLIGGKLADRAARGGVSGYAKQPMVVLLASTPFLGVTP
FAPNLPLALAALAVGVFLHAMAYGPTFASVQVLASPRVRATASAILFFLTSLIGLGLGPL
AVGVASDLLRASLGPVQSLNLACAGASITMVASVVCFGFAARQMSGEAPARSASVSSGA