Protein Info for CCNA_01892 in Caulobacter crescentus NA1000

Annotation: short chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 546 PF00106: adh_short" amino acids 33 to 221 (189 residues), 190.9 bits, see alignment E=4.5e-60 amino acids 299 to 478 (180 residues), 170.7 bits, see alignment E=6.6e-54 PF08659: KR" amino acids 35 to 191 (157 residues), 37 bits, see alignment E=8.7e-13 amino acids 300 to 468 (169 residues), 34.9 bits, see alignment E=3.8e-12 PF13561: adh_short_C2" amino acids 41 to 274 (234 residues), 220.1 bits, see alignment E=8e-69 amino acids 305 to 534 (230 residues), 223.7 bits, see alignment E=6.4e-70

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_01892)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7N6 at UniProt or InterPro

Protein Sequence (546 amino acids)

>CCNA_01892 short chain dehydrogenase (Caulobacter crescentus NA1000)
MARGGALLGFREGRHPRRPHETEYAMTSKAQSRVVLVTGGADGIGWAACQRFARAGDQVL
VADRNVERARERADSLGPDHHAIAMDVSSEAQIREGFEQLHREFGRLDVLVNNAGVTDPQ
PTATLDQTAEEVARLQAINVTGAFLAAREAGRLMIEQGHGAIINLASGAGLVALAKRTSY
SASKAAVISLTRTLACEWAAKGVRVNAVLPGYTRTQMVQDQIDAGLLDPSIVLSRIPLGR
MGEPEEMAEGAFFLASDAASYVVGATLVVDGGYTVYGGSGPASTTPAPSPLAPSPRVSAI
TGGGRGIGRCVVDLFHAAGDRLLVIERDAEGAKALAEALGDEHIVVQADITDVAAVEAAF
AQAQARWGRLDVLINNAGAADVFKPSLEQTAQDFTSVYDLNFSGPLATAKAAARLMSQGG
VIVNLGSIAGLGALPQRNAYCAAKAAVTMMSRSLACEWASAGIRVNTVAPGYIETPAVLA
LKSAGRAQFDKIRRRAPIGRLGDPMEVARTIAFLASPAASYVAGATLTVDGGWTAFGDAG
DASDIL