Protein Info for CCNA_01885 in Caulobacter crescentus NA1000

Annotation: short chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 15 to 206 (192 residues), 166.5 bits, E=7.7e-53
• PF08659: KR
  • amino acids 18 to 167 (150 residues), 30.1 bits, E=6.6e-11
• PF13561: adh_short_C2
  • amino acids 20 to 253 (234 residues), 198.6 bits, E=1.8e-62

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_01885)

Predicted SEED Role

"Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140)" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization (EC 1.1.1.140)

MetaCyc Pathways

• D-sorbitol degradation II (1/1 steps found)
• L-sorbose degradation (1/2 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (11/19 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.140

Use Curated BLAST to search for 1.1.1.140

Sequence Analysis Tools

See A0A0H3CAJ4 at UniProt or InterPro

Protein Sequence (258 amino acids)

>CCNA_01885 short chain dehydrogenase (Caulobacter crescentus NA1000)
MREEGTMAGRLEGRVAAVTGASRGLGRATAALLAAEGAMVALLDLKAHWAQAAADEIIAA
GGKAVGLGCDVSDREALTATLGAVNDAHGRFDVLVNNAMWNVYEPLAAIRPESLDRMVSV
GFSGVIWGMQAAAPLMAASGGGSIVNIASVSAQLGIPNGIAYCGVKAGVAGMTRAAAAEL
GAMNIRVNAVAPSTVDTEGVRRVVSEERIAMRIGQTPLGRLGTTEDIAKAVRYLACDDSD
FVTGQMLTVDGGLATALS