Protein Info for CCNA_01855 in Caulobacter crescentus NA1000

Annotation: iron/manganese superoxide dismutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00081: Sod_Fe_N" amino acids 37 to 120 (84 residues), 90.9 bits, see alignment E=5.9e-30 PF02777: Sod_Fe_C" amino acids 128 to 230 (103 residues), 129.9 bits, see alignment E=3.4e-42

Best Hits

Swiss-Prot: 54% identical to SODM_ACIAD: Superoxide dismutase [Mn] (sodA) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K04564, superoxide dismutase, Fe-Mn family [EC: 1.15.1.1] (inferred from 100% identity to ccs:CCNA_01855)

Predicted SEED Role

"Manganese superoxide dismutase (EC 1.15.1.1)" in subsystem Nitric oxide synthase or Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.15.1.1

Use Curated BLAST to search for 1.15.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8Y7 at UniProt or InterPro

Protein Sequence (238 amino acids)

>CCNA_01855 iron/manganese superoxide dismutase (Caulobacter crescentus NA1000)
MQRLLTAIAISAFGITTPVLAQTSPAPQVAAAPQPAFTLAPLPYVYEALSPVIDTETMRI
HHGRHHQAYVNALNGAVAVTPALQGKSLDAVLSEVSRHPPVVRNNAGGHYNHTLFWSLMA
PSGAGGAPSSKLLAQIDKDFGSLDAFKKAFETAGLQRFGSGWAWLIWSEGKLRVVSTPNQ
DNPLMDDAPVKGAPILANDVWEHAYYLKHQNNRGAYLGGWWQVVNWNKANALFDAAAR