Protein Info for CCNA_01851 in Caulobacter crescentus NA1000

Annotation: quinol cytochrome oxidase polypeptide II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 48 to 71 (24 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 182 to 197 (16 residues), see Phobius details TIGR01433: ubiquinol oxidase, subunit II" amino acids 18 to 249 (232 residues), 354.8 bits, see alignment E=8.6e-111 PF00116: COX2" amino acids 161 to 231 (71 residues), 26.5 bits, see alignment E=5.1e-10 PF06481: COX_ARM" amino acids 250 to 295 (46 residues), 56.3 bits, see alignment 2.4e-19

Best Hits

KEGG orthology group: K02297, cytochrome o ubiquinol oxidase subunit II [EC: 1.10.3.-] (inferred from 100% identity to ccs:CCNA_01851)

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C994 at UniProt or InterPro

Protein Sequence (353 amino acids)

>CCNA_01851 quinol cytochrome oxidase polypeptide II (Caulobacter crescentus NA1000)
MRTRFSSPLSSRALKSLLLAPAVLALGGCDWVVMNPSGDIAAQQRDLIILATVLMLLIIV
PVIALTLFFAWKYRASNEEATYAPDWHHSTRLEIIIWAAPLIIITILGAVTWSSTHLLDP
YRPLDRIAPGRSAENIKPLKVQVVALDWKWLFIYPELGIATVNEMAAPVDRPLNFELTSS
SVMNSFYVPALAGQIYAMPGMKTKLHAVINKPGQFEGFSANYSGDGFSHMRFKFHGMSEA
DFKRWVDGVRAGSGRLDRSRYLDLERPSEKQPVLRFASVDSGLFGAAVDRCVEPGKMCHH
DMAAIDARGGLGMAGVYNVTTLEYDKRTRRGEGGGFRSFVAALCAPITGASAR