Protein Info for CCNA_01849 in Caulobacter crescentus NA1000

Annotation: quinol cytochrome oxidase polypeptide III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00510: COX3
  • amino acids 25 to 205 (181 residues), 52.5 bits, E=3.2e-18
• TIGR02842: cytochrome o ubiquinol oxidase, subunit III
  • amino acids 28 to 207 (180 residues), 266.5 bits, E=8e-84

Best Hits

Swiss-Prot: 59% identical to CYOC_PSEPU: Cytochrome bo(3) ubiquinol oxidase subunit 3 (cyoC) from Pseudomonas putida

KEGG orthology group: K02299, cytochrome o ubiquinol oxidase subunit III [EC: 1.10.3.-] (inferred from 100% identity to ccr:CC_1771)

MetaCyc: 59% identical to cytochrome bo terminal oxidase subunit III (Pseudomonas putida KT2440)
RXN0-5268 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit III (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (2/2 steps found)
• D-lactate to cytochrome bo oxidase electron transfer (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer II (1/2 steps found)
• glycerol-3-phosphate to cytochrome bo oxidase electron transfer (1/2 steps found)
• proline to cytochrome bo oxidase electron transfer (1/2 steps found)
• pyruvate to cytochrome bo oxidase electron transfer (1/2 steps found)
• succinate to cytochrome bo quinol oxidase (cyanobacteria, cytoplamic membrane) (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

See A0A0H3C8B9 at UniProt or InterPro

Protein Sequence (208 amino acids)

>CCNA_01849 quinol cytochrome oxidase polypeptide III (Caulobacter crescentus NA1000)
MGAHSQAVSAADTDQFYLTKEHHPENGTLLGFWIYLMSDCLIFAVLFACYAVLGQSYAAG
PSGADLFDLKLVAINTGLLLLSSITYGFAMIAAQAREVRPVLIWLGVTGLLGVGFLSLEI
YEFAHLIHEGATPQRSAFLSAFFLLVGTHGLHVTFGVIWLVTLMVQVAQRGLGIEMRRRL
MCLSMFWHFLDVIWIGVFSFVYLLGVLK