Protein Info for CCNA_01848 in Caulobacter crescentus NA1000

Annotation: quinol cytochrome oxidase polypeptide IV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02847: cytochrome o ubiquinol oxidase subunit IV
  • amino acids 22 to 118 (97 residues), 114 bits, E=1.8e-37
• PF03626: COX4_pro
  • amino acids 29 to 102 (74 residues), 63.8 bits, E=8.1e-22

Best Hits

Swiss-Prot: 49% identical to CYOD_PSEAE: Cytochrome bo(3) ubiquinol oxidase subunit 4 (cyoD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02300, cytochrome o ubiquinol oxidase operon protein cyoD (inferred from 100% identity to ccs:CCNA_01848)

MetaCyc: 43% identical to cytochrome bo terminal oxidase subunit IV (Pseudomonas putida KT2440)
RXN0-5268 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit IV (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (2/2 steps found)
• D-lactate to cytochrome bo oxidase electron transfer (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer II (1/2 steps found)
• glycerol-3-phosphate to cytochrome bo oxidase electron transfer (1/2 steps found)
• proline to cytochrome bo oxidase electron transfer (1/2 steps found)
• pyruvate to cytochrome bo oxidase electron transfer (1/2 steps found)
• succinate to cytochrome bo quinol oxidase (cyanobacteria, cytoplamic membrane) (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

See A0A0H3C7K0 at UniProt or InterPro

Protein Sequence (129 amino acids)

>CCNA_01848 quinol cytochrome oxidase polypeptide IV (Caulobacter crescentus NA1000)
MSAASHDAHPHDEHGDAHEAAHGTLKDYVIGFVLAVILTAIPFWLVMGDVLPSAQMTAVA
VMGLAVIQVVVHMIYFLHMNTRSEGGWTMLALIFTLILVVITLAGSLWVMHNLNTHMMPE
MMPDMRQAP