Protein Info for CCNA_01841 in Caulobacter crescentus NA1000

Annotation: isocitrate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 539 PF13714: PEP_mutase" amino acids 152 to 268 (117 residues), 42.7 bits, see alignment E=5.3e-15 PF00463: ICL" amino acids 179 to 272 (94 residues), 66.9 bits, see alignment E=1.4e-22 amino acids 320 to 404 (85 residues), 37.3 bits, see alignment E=1.3e-13 amino acids 447 to 536 (90 residues), 41 bits, see alignment E=9.6e-15

Best Hits

Swiss-Prot: 81% identical to ACEA_HYPME: Isocitrate lyase (aceA) from Hyphomicrobium methylovorum

KEGG orthology group: K01637, isocitrate lyase [EC: 4.1.3.1] (inferred from 100% identity to ccs:CCNA_01841)

Predicted SEED Role

"Isocitrate lyase (EC 4.1.3.1)" in subsystem Serine-glyoxylate cycle (EC 4.1.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C983 at UniProt or InterPro

Protein Sequence (539 amino acids)

>CCNA_01841 isocitrate lyase (Caulobacter crescentus NA1000)
MTQRKTYAEHRDALLARYPQGVTPGGVDVDDIIQLKLQNTFNTHLDIARAMAPVMRADMA
EYDRDSSKFTQSLGCWSGFHAQQMIKAVKRLRGTTKGAYVYLSGWMVAGLRNRFGHLPDQ
SMHEKTSVVDLIEEIYVSLRQADEVAINDLFKALSAARKAGDQIAEQAAIKAIDNFETHV
VPIIADIDAGFGNEHATYLLAKEMIKAGACCLQIENQVSDAKQCGHQDGKVTVPREDFIE
KLRACRLAFEELGVDDGVIVARTDSLGAGLTQKIPVSQEPGDLASDYIKWLKTEPVTPEN
PLKDGELAIMKDGAFVKPVRMPNGLFAFQDGTGRQRVIEDCIANLTQGGADLLWIETDTP
NVDEIASMVAEVRRVVPNAKLTYNNSPSFNWTLNLRKQVRDQWIAEGKIHKDSYPDGNAL
MSAEYDKSDLGREADERLARFQVDIAARAGVFHNLITLPTFHLTAKSVDELSRGYFGEDR
MQAYVNTVQREEIRRGVSAVKHQHEVGSDLGDTFKEMVAGERALKAGGHANTMNQFAAE