Protein Info for CCNA_01840 in Caulobacter crescentus NA1000

Annotation: MerR-family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 PF13560: HTH_31" amino acids 15 to 69 (55 residues), 46.8 bits, see alignment 7.6e-16 PF12844: HTH_19" amino acids 16 to 69 (54 residues), 33.1 bits, see alignment 1.2e-11 PF01381: HTH_3" amino acids 19 to 71 (53 residues), 42.5 bits, see alignment 1.3e-14 PF06114: Peptidase_M78" amino acids 197 to 320 (124 residues), 85.9 bits, see alignment E=4.8e-28 PF09856: ScfRs" amino acids 321 to 476 (156 residues), 206.2 bits, see alignment E=6.7e-65

Best Hits

KEGG orthology group: K07110, (no description) (inferred from 100% identity to ccs:CCNA_01840)

Predicted SEED Role

"Transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8X6 at UniProt or InterPro

Protein Sequence (480 amino acids)

>CCNA_01840 MerR-family transcriptional regulator (Caulobacter crescentus NA1000)
MATLEKKQNDKKLFLGGRLKRLRRDLGVTQARMAEELGVSASYLNLLERNQRPVTAQILL
RLADAYDLDLRSLSADDPGGGAGLEEVLADRMFADLAVSRHEAAEVAELSPGIAEAMSRL
YRAYLDRGRLIDLGAFERPDGAGPASDLSSPTDWVRDLVGAQRNHFTELEALAESIVRQL
KADPQDLGPAVRERLQSRFGVQTRIMPLEVMTGSLRRYDHHRKRLMLSETLAHASRTFGM
CYQLGLMEGGEVLTELTDRFKAPDRATRQLLKVFLDGYLAAAIMMPYEPFLAAMESTGYD
IERVRSRFGISYEQAAQRLTTLGRAGSRGVPFFMMRLDAAGNISKRFAAGPFPFSRFGGA
CPRWNVHDSFKTPGRIVTQVIETPDGERYFTLSRTVRRTSGLQAGLEDELVVGLGCELKY
ASKLVHARGLDIANPIAVEIGPSCRICERPACPQRAAAPINRTLMVEETSKALSPFPFVR