Protein Info for CCNA_01836 in Caulobacter crescentus NA1000

Annotation: acyl-CoA thioesterase I/lysophospholipase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00657: Lipase_GDSL
  • amino acids 33 to 201 (169 residues), 52.7 bits, E=6.5e-18
• PF13472: Lipase_GDSL_2
  • amino acids 35 to 195 (161 residues), 92.7 bits, E=4.1e-30

Best Hits

Swiss-Prot: 41% identical to EST_PSEAE: Esterase TesA (tesA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01076, [EC: 3.1.2.-] (inferred from 100% identity to ccr:CC_1760)

Predicted SEED Role

"Arylesterase precursor (EC 3.1.1.2)" (EC 3.1.1.2)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.1.2 or 3.1.2.-

Sequence Analysis Tools

See A0A0H3C7J0 at UniProt or InterPro

Protein Sequence (210 amino acids)

>CCNA_01836 acyl-CoA thioesterase I/lysophospholipase (Caulobacter crescentus NA1000)
MSQTAHRFPNRRRFLLGIGLLSQIAAAPKPVVITVLGDSITAGLGLPAREAMPAQLQSAL
GRRGISAVVRPAGVSGDTSGGGLARLGFSVSKDTQLCVVALGGNDLLQGVDPAQTKANLR
GVLQKLKARNVRAVLVGVAAPARIGASYARDFNAIYPSLAKEFGVPLYANILAGVVGNPA
LMQRDGIHPNAQGAKKIGEALAAVVAKAVS