Protein Info for CCNA_01835 in Caulobacter crescentus NA1000
Annotation: ABC transporter ATP-binding protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 51% identical to LOLD2_CAUVC: Lipoprotein-releasing system ATP-binding protein LolD 2 (lolD2) from Caulobacter vibrioides (strain ATCC 19089 / CB15)
KEGG orthology group: K02003, (no description) (inferred from 100% identity to ccr:CC_1759)MetaCyc: 46% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427
Predicted SEED Role
"ABC transporter ATP-binding protein YvcR"
MetaCyc Pathways
- lipoprotein posttranslational modification (Gram-negative bacteria) (2/7 steps found)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0H3CAF2 at UniProt or InterPro
Protein Sequence (228 amino acids)
>CCNA_01835 ABC transporter ATP-binding protein (Caulobacter crescentus NA1000) MSDDVTPAAPLVLDAVALTLPSSAGPVNILRGVDLVVNPGERVAIIGPSGSGKSSLIAVG AGLEEPTSGQVRLFGQDLAKLNEDGRARLRRGRAALVFQSFHLLPNMTAEENVATPLEID GARDAMATARDWLGRVGLSGRLTHYPHQLSGGEQQRVALARALAARPALLFADEPTGNLD GATATSVADLMFNLVTEVGAAMVMVTHDPVLATRADRIVRMADGRIVS