Protein Info for CCNA_01834 in Caulobacter crescentus NA1000

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 840 signal peptide" amino acids 1 to 44 (44 residues), see Phobius details transmembrane" amino acids 259 to 286 (28 residues), see Phobius details amino acids 308 to 334 (27 residues), see Phobius details amino acids 354 to 375 (22 residues), see Phobius details amino acids 396 to 416 (21 residues), see Phobius details amino acids 422 to 442 (21 residues), see Phobius details amino acids 480 to 500 (21 residues), see Phobius details amino acids 719 to 740 (22 residues), see Phobius details amino acids 761 to 787 (27 residues), see Phobius details amino acids 806 to 830 (25 residues), see Phobius details PF02687: FtsX" amino acids 263 to 382 (120 residues), 41.8 bits, see alignment E=4.8e-15 amino acids 720 to 830 (111 residues), 58.4 bits, see alignment E=3.5e-20

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 100% identity to ccs:CCNA_01834)

Predicted SEED Role

"FIG00809136: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C977 at UniProt or InterPro

Protein Sequence (840 amino acids)

>CCNA_01834 oxidoreductase (Caulobacter crescentus NA1000)
MSRTPLAFRLAARELRSGVRGFRIFLACLALGVAAIAAAGSTAEAFRQGLASQAREILGG
DLAFSVENRDFTPKERQTFDKLGVTTYAATARAMAQAPSGERRLVNLRGVDGQFPLAGAV
TLEGAPNLQAALADRNGVPGAAVEPALMDRLNLKIGDRFEAGPMTLVVGARLTGEPDGLS
RGFAIAPRVLVRGEVLERSGLLAPGGLTSRTVRVALSPNQDPRAVGKAVQASLPDSRMRV
RDRLDAAPGARRLIDQLEYFLGFIGLASLVAGGLGVAGAVSAYLSAREPAIAVLKALGAQ
SGLIRDLHLIQIAVLALLGIAIGLVVGGAAPLILGQLAGSSLPVPALFKVYPLPLAKAAL
FGLLAAAAFSLLPLARARTTPPSALFRRAPKGRLPFGVETVGAALAGLGLAALAVATAPT
PMAAAIMIAGVAVSFGLLAALGRSAAWAAGKARGLTRGPAKLGLANLAGPRSAARTASPA
IGLGVALLACVVLIQSALLAQVSDVAPRTAPAMVFTEIPADQAATFDATAASVMGPLTED
AYLRMPFVTGRIIAVKGKPIDPKSVKPSARWAFDNDISLSTLGKEPKNAGVVAGRWWAEN
DTGPPKLAMSAEIAEAAGLKLGDTVTLLVLGQEIQARITVLRTIEFGGFGPNFNLILNPA
TLEGAELRSVAIARMDKAQEAALTRKLGQTLPTVNVISVREQLESAAALFDRLALAVRGA
AAVAGLAGLLVLAGAIAAGARARAREAATLKVLGATRGQILLAYVIEYGAVGLIAGAAGV
LFGFAAAWPVVVKVFEATWSVDWSGVLALLAGATGLATLGGLIAASLALAQRPAPVLRGD