Protein Info for CCNA_01820 in Caulobacter crescentus NA1000

Annotation: GTP-binding protein hflX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 TIGR03156: GTP-binding protein HflX" amino acids 35 to 377 (343 residues), 458.3 bits, see alignment E=7.8e-142 PF13167: GTP-bdg_N" amino acids 40 to 127 (88 residues), 97.6 bits, see alignment E=1.1e-31 PF16360: GTP-bdg_M" amino acids 129 to 208 (80 residues), 100.9 bits, see alignment E=9.3e-33 PF01926: MMR_HSR1" amino acids 215 to 337 (123 residues), 74.9 bits, see alignment E=1.1e-24 PF19275: HflX_C" amino acids 349 to 437 (89 residues), 45 bits, see alignment E=1.9e-15

Best Hits

KEGG orthology group: K03665, GTP-binding protein HflX (inferred from 100% identity to ccs:CCNA_01820)

Predicted SEED Role

"GTP-binding protein HflX" in subsystem Hfl operon or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7H6 at UniProt or InterPro

Protein Sequence (446 amino acids)

>CCNA_01820 GTP-binding protein hflX (Caulobacter crescentus NA1000)
MSKSSSKSIDHAAPILKALVIHPARPLRGQAALEARDPNARLEEAVGLAVALDLNVVEAL
VAPLRVVTPATLFGKGKVEEFAAICEVEHIDVAVFDDQLTPIQQRNLEKALKVKVVDRTG
LILEIFARRARTREGRLQVELARLDYERSRLVRTWTHLERQRGGTGSTGGPGETQIEIDR
RLIAGTILKLKKELEEVRRTRTLHRSARKKVPYPTVALVGYTNAGKSTLFNRLTEAEVLA
KDMLFATLDPTLRTVKLPDGRPAIMSDTVGFISDLPHELVEAFRATLEEVQEADVVLHVR
DVANPDSEAQARDVETVLAELGVTLDEGKTVVEVWNKVDLLSEDDREIVEGQARRNDASA
VSAVTGEGCEALLRRIAGLIDDSPPVEVSLAAQDGQALAWIYRNGRVLSRYDGPGGEVTL
VARLDAQALGRFERQFPGAQVSAAVD