Protein Info for CCNA_01815 in Caulobacter crescentus NA1000

Annotation: nitrogen assimilation regulatory protein NtrC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 PF00072: Response_reg" amino acids 8 to 117 (110 residues), 89.2 bits, see alignment E=7.1e-29 PF00158: Sigma54_activat" amino acids 144 to 301 (158 residues), 157.4 bits, see alignment E=1e-49 PF14532: Sigma54_activ_2" amino acids 145 to 306 (162 residues), 80.5 bits, see alignment E=5.2e-26 PF07728: AAA_5" amino acids 168 to 277 (110 residues), 26.2 bits, see alignment E=2.4e-09 PF02954: HTH_8" amino acids 424 to 462 (39 residues), 50.7 bits, see alignment 4.1e-17

Best Hits

Swiss-Prot: 60% identical to NTRC_AZOC5: DNA-binding transcriptional regulator NtrC (ntrC) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K07712, two-component system, NtrC family, nitrogen regulation response regulator GlnG (inferred from 100% identity to ccs:CCNA_01815)

Predicted SEED Role

"Nitrogen regulation protein NtrC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8A1 at UniProt or InterPro

Protein Sequence (473 amino acids)

>CCNA_01815 nitrogen assimilation regulatory protein NtrC (Caulobacter crescentus NA1000)
MNAASKKILIADDDSSIRLVLSQAFTRLGYQVRATGNATTLLKWVTDGEGDLVVTDVMMP
DENVFDVLPRIRKERPKLPIIVMSAQNTLLTAVNAADAGAFEYVSKPFDLDDVTAAARRA
LSRPADTEASKAQARAMRDERLPLIGRSAPMQEVYRTIARLVGADLTVLILGESGTGKEL
VARALHELGRRRDGKFVVINLAAVPRERVEAELFGRGEGDNGRLVEADGGTLFLDEIGDM
PLDAQTRLLRVIDGTEPVINPKTGRRPNVRIIAATNRDLRGLIQQGLFREDLFFRLNVAP
VRLPPLRDRAEDIPDLARTFLLRAAREGLPAKTIDQGALDRLKSHPWPGNVRELENLMRR
MCALYAEELITSRIVDRELQDHAPAVRAEEGPVTLSTLVERHLASHFADQPDGVPAPGLY
DRILEEVERPLIQLTLSATRGNQVRAAEILGLNRNTLRKKIQDLGVEMTRGRR