Protein Info for CCNA_01800 in Caulobacter crescentus NA1000

Annotation: pyruvate dehydrogenase E1 component beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 PF00364: Biotin_lipoyl" amino acids 3 to 76 (74 residues), 76.1 bits, see alignment E=3e-25 PF13533: Biotin_lipoyl_2" amino acids 15 to 50 (36 residues), 27.9 bits, see alignment 3.2e-10 PF02779: Transket_pyr" amino acids 126 to 301 (176 residues), 157.1 bits, see alignment E=7.3e-50 PF02780: Transketolase_C" amino acids 318 to 440 (123 residues), 149.5 bits, see alignment E=8.5e-48

Best Hits

Swiss-Prot: 66% identical to ODPB_RHIME: Pyruvate dehydrogenase E1 component subunit beta (pdhB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00162, pyruvate dehydrogenase E1 component subunit beta [EC: 1.2.4.1] (inferred from 100% identity to ccr:CC_1727)

Predicted SEED Role

"Pyruvate dehydrogenase E1 component beta subunit (EC 1.2.4.1)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.4.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.1

Use Curated BLAST to search for 1.2.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C950 at UniProt or InterPro

Protein Sequence (450 amino acids)

>CCNA_01800 pyruvate dehydrogenase E1 component beta subunit (Caulobacter crescentus NA1000)
MTDILMPALSPTMEEGTLAKWLVKEGDTIKAGDVIAEIETDKATMEVEAVDEGVIEAILV
PAGSENVKVNTLIARLKGDGEAAAPAVAAPVAEAATVVVAAPAAGGPISAASTFADPEIP
TGTALKKITVRDALRDAMAEEMRRDDRVFLMGEEVAQYQGAYKVSRELLQEFGDRRVIDT
PITEHGFAGMGVGAAMAGLKPIVEFMTWNFAMQAIDHIINSAAKTLYMSGGQIKSSIVFR
GPNGAASRVGAQHSQDYAAWYGNVPGLKVIAPYDAADAKGLLKAAIRDPNPVVFLEHEMM
YGHEFDIPDVEDWVVPIGKAKVRRQGSDVTLVAYSRMVGFALKAAEELEKEGIAAEVVDL
RTIRPMDHATILESVKKTNRLVTVEEGWGPMGVGAEIVARITEFGFDYLDAPPLRVCQED
VPLPYAANLEALSLPSVEKIVKAAKAVCYK