Protein Info for CCNA_01799 in Caulobacter crescentus NA1000

Annotation: pyruvate dehydrogenase E1 component alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03182: pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit
  • amino acids 25 to 338 (314 residues), 509.6 bits, E=1.3e-157
• PF00676: E1_dh
  • amino acids 34 to 330 (297 residues), 339.9 bits, E=1.6e-105
• PF02775: TPP_enzyme_C
  • amino acids 130 to 207 (78 residues), 22 bits, E=1.9e-08
• PF13292: DXP_synthase_N
  • amino acids 136 to 202 (67 residues), 22.3 bits, E=1.1e-08

Best Hits

Swiss-Prot: 69% identical to ODPA_RHIME: Pyruvate dehydrogenase E1 component subunit alpha (pdhA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00161, pyruvate dehydrogenase E1 component subunit alpha [EC: 1.2.4.1] (inferred from 100% identity to ccr:CC_1726)

MetaCyc: 51% identical to pyruvate dehydrogenase E1 component alpha subunit (somatic) (Homo sapiens)

Predicted SEED Role

"Pyruvate dehydrogenase E1 component alpha subunit (EC 1.2.4.1)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.4.1)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle III (animals) (9/10 steps found)
• TCA cycle VIII (Chlamydia) (6/6 steps found)
• TCA cycle II (plants and fungi) (8/9 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• pyruvate fermentation to acetate V (3/3 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (7/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (12/17 steps found)
• pyruvate fermentation to acetate II (1/3 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (1/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Butanoate metabolism
• Citrate cycle (TCA cycle)
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.1

Use Curated BLAST to search for 1.2.4.1

Sequence Analysis Tools

See A0A0H3C8U6 at UniProt or InterPro

Protein Sequence (343 amino acids)

>CCNA_01799 pyruvate dehydrogenase E1 component alpha subunit (Caulobacter crescentus NA1000)
MARTRKAEASEGKAPETGVNAFVGKDELLKFYQDMLLIRRFEERAGQLYGMGLIGGFCHL
YIGQEAIAVGMQSISQKGDQIITGYRDHGHMLAAGMDPREVMAELTGRAGGSSKGKGGSM
HMFDIATGFYGGHGIVGAQVALGTGLALANSYRNNGNVSYAYMGDGAANQGQVYESFNMA
QLWKLPVVYVIENNQYAMGTAVERAASETAFHKRGVSFRIPGEEVDGMDVIAVREAGARA
TEHARSGQGPYILEMKTYRYRGHSMSDPAKYRTKEEVDEVKTTRDPIDHIKERLAKAGVT
EDDLKGVDAEVKRIVAEAAEFARTSPEPDPSELYTDVYLEAAE