Protein Info for CCNA_01799 in Caulobacter crescentus NA1000

Annotation: pyruvate dehydrogenase E1 component alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 transmembrane" amino acids 48 to 62 (15 residues), see Phobius details TIGR03182: pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit" amino acids 25 to 338 (314 residues), 509.6 bits, see alignment E=1.3e-157 PF00676: E1_dh" amino acids 34 to 330 (297 residues), 339.9 bits, see alignment E=1.6e-105 PF02775: TPP_enzyme_C" amino acids 130 to 207 (78 residues), 22 bits, see alignment E=1.9e-08 PF13292: DXP_synthase_N" amino acids 136 to 202 (67 residues), 22.3 bits, see alignment E=1.1e-08

Best Hits

Swiss-Prot: 69% identical to ODPA_RHIME: Pyruvate dehydrogenase E1 component subunit alpha (pdhA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00161, pyruvate dehydrogenase E1 component subunit alpha [EC: 1.2.4.1] (inferred from 100% identity to ccr:CC_1726)

MetaCyc: 51% identical to pyruvate dehydrogenase E1 component alpha subunit (somatic) (Homo sapiens)

Predicted SEED Role

"Pyruvate dehydrogenase E1 component alpha subunit (EC 1.2.4.1)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.4.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.1

Use Curated BLAST to search for 1.2.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8U6 at UniProt or InterPro

Protein Sequence (343 amino acids)

>CCNA_01799 pyruvate dehydrogenase E1 component alpha subunit (Caulobacter crescentus NA1000)
MARTRKAEASEGKAPETGVNAFVGKDELLKFYQDMLLIRRFEERAGQLYGMGLIGGFCHL
YIGQEAIAVGMQSISQKGDQIITGYRDHGHMLAAGMDPREVMAELTGRAGGSSKGKGGSM
HMFDIATGFYGGHGIVGAQVALGTGLALANSYRNNGNVSYAYMGDGAANQGQVYESFNMA
QLWKLPVVYVIENNQYAMGTAVERAASETAFHKRGVSFRIPGEEVDGMDVIAVREAGARA
TEHARSGQGPYILEMKTYRYRGHSMSDPAKYRTKEEVDEVKTTRDPIDHIKERLAKAGVT
EDDLKGVDAEVKRIVAEAAEFARTSPEPDPSELYTDVYLEAAE