Protein Info for CCNA_01746 in Caulobacter crescentus NA1000

Annotation: malonyl-CoA-(acyl-carrier-protein) transacylase FabD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 TIGR00128: malonyl CoA-acyl carrier protein transacylase" amino acids 1 to 295 (295 residues), 294 bits, see alignment E=6.9e-92 PF00698: Acyl_transf_1" amino acids 5 to 278 (274 residues), 135.1 bits, see alignment E=2e-43

Best Hits

Swiss-Prot: 46% identical to FABD_ECOLI: Malonyl CoA-acyl carrier protein transacylase (fabD) from Escherichia coli (strain K12)

KEGG orthology group: K00645, [acyl-carrier-protein] S-malonyltransferase [EC: 2.3.1.39] (inferred from 100% identity to ccs:CCNA_01746)

MetaCyc: 46% identical to [acyl-carrier-protein] S-malonyltransferase (Escherichia coli K-12 substr. MG1655)
[Acyl-carrier-protein] S-malonyltransferase. [EC: 2.3.1.39]

Predicted SEED Role

"Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 2.3.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C853 at UniProt or InterPro

Protein Sequence (314 amino acids)

>CCNA_01746 malonyl-CoA-(acyl-carrier-protein) transacylase FabD (Caulobacter crescentus NA1000)
MSIAFIFPGQGSQSVGMGADLAEAFSAAREVFQEVDDALGQKLFALMKEGPEGDLTLTEN
AQPALMAVSLAVTRTLEKEFGVGIDKAAFVAGHSLGEYSALAAAGAISLSDTARLLKLRG
QAMQRAVPVGEGAMASLIGPKTDLALAEAAAAAGSEVGVCVVANDNNNGNVVISGAKAAV
DKAIEKAKELGARAIPLNVSAPFHCPLMQPAADEMATALAAATIVAPRAPLVANVTAAPI
HDPDVIRKLLVEQVTGRVRWRESMTWMATEGGVTRFAEAGAGKVLSGMAKRIAPDAEAVP
LNTPADLEAFAKSL