Protein Info for CCNA_01735 in Caulobacter crescentus NA1000

Annotation: PaaI thioesterase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 transmembrane" amino acids 56 to 76 (21 residues), see Phobius details TIGR00369: uncharacterized domain 1" amino acids 34 to 134 (101 residues), 40.8 bits, see alignment E=1e-14 PF13622: 4HBT_3" amino acids 51 to 133 (83 residues), 33.3 bits, see alignment E=4.7e-12 PF03061: 4HBT" amino acids 53 to 128 (76 residues), 47.6 bits, see alignment E=1.8e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_1663)

Predicted SEED Role

"FIG00481680: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8U7 at UniProt or InterPro

Protein Sequence (161 amino acids)

>CCNA_01735 PaaI thioesterase family protein (Caulobacter crescentus NA1000)
MTWATDRLDACKAGSATPPPIVRTLKLGLLDDWGEGWVRKSWRPDPDLATADGSLFGGYL
AALADQILAFAAMTVVPNDRLYRTVNLQLNFLKVSRNEPLAIEARVVAQTRQLITARAEF
RRLDGTLIAEATAQQIVLAFEHRPAEQAALDAMDNGQTPGV