Protein Info for CCNA_01723 in Caulobacter crescentus NA1000

Annotation: 3-methyl-2-oxobutanoate hydroxymethyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to PANB_CAUVN: 3-methyl-2-oxobutanoate hydroxymethyltransferase (panB) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K00606, 3-methyl-2-oxobutanoate hydroxymethyltransferase [EC: 2.1.2.11] (inferred from 100% identity to ccs:CCNA_01723)

MetaCyc: 46% identical to 3-methyl-2-oxobutanoate hydroxymethyltransferase (Thermococcus kodakarensis)
3-methyl-2-oxobutanoate hydroxymethyltransferase. [EC: 2.1.2.11]

Predicted SEED Role

"3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11)" in subsystem Coenzyme A Biosynthesis (EC 2.1.2.11)

MetaCyc Pathways

superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
phosphopantothenate biosynthesis I (4/4 steps found)
superpathway of coenzyme A biosynthesis II (plants) (8/10 steps found)
phosphopantothenate biosynthesis III (archaea) (2/4 steps found)

KEGG Metabolic Maps

Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GVL8 at UniProt or InterPro

Protein Sequence (275 amino acids)

>CCNA_01723 3-methyl-2-oxobutanoate hydroxymethyltransferase (Caulobacter crescentus NA1000)
MSAHREETVRRLAAPDIAARKGGVPIVCLTAYTAPVAAALDDACDVLLVGDSVGMVVHGL
PNTVGVTMEMMILHGQAVMRGSKKAMVVVDMPFGSYEASHEEAYANAVRIMKETGAQAVK
VESGPTVPETIAYLTRRGVPVMGHVGLRPQAVLLEGGFKAKGKDDAGRAKVLEEARLTAE
AGAFAIVVEGVAESLAREVTESVSVPTIGIGASAGCDGQVLVVDDMLGLFDWTPKFVRRY
ADLKGEIERAAAQYASDVRDRSFPGPAETYYAKKP