Protein Info for CCNA_01715 in Caulobacter crescentus NA1000

Annotation: GPH-family phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 PF00702: Hydrolase" amino acids 16 to 183 (168 residues), 62.5 bits, see alignment E=1.4e-20 PF12710: HAD" amino acids 18 to 180 (163 residues), 47.9 bits, see alignment E=4.7e-16 PF13419: HAD_2" amino acids 18 to 189 (172 residues), 105.1 bits, see alignment E=9.6e-34 PF13242: Hydrolase_like" amino acids 159 to 211 (53 residues), 23 bits, see alignment E=1.2e-08

Best Hits

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 100% identity to ccr:CC_1643)

Predicted SEED Role

"hydrolase, haloacid dehalogenase-like family"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C789 at UniProt or InterPro

Protein Sequence (228 amino acids)

>CCNA_01715 GPH-family phosphatase (Caulobacter crescentus NA1000)
MEGISRVGKNAVSRYELVIFDFDGTLADSAAWMMRAVNPMARRYGFKTVTEDEIEMLRGR
STREVIRYLGVSPWKLPLIARAGKKLMAADAHTIPLFPETEKMLRALHAAGVKIAVVSSN
SETVIRRVLGEELGNLISLYACGASLFGKARKFRQVTRQGVARDKIICIGDETRDIEAAR
AVGLDCGAVGWGYAKPSILAQHGPTVSFNSMSEIISYVGASKAAVGGD