Protein Info for CCNA_01705 in Caulobacter crescentus NA1000

Updated annotation (from data): 3-keto-glycoside 1,2-lyase
Rationale: Specifically important for the utilization of lactose, as part of the 3-ketoglycoside pathway. (3'-ketolactose is formed by LacABC, which are encoded on either side.) Also involved in raffinose utilization. Distantly related to the 3-keto-glycoside 1,2-lyase BT2157, which is more active on alpha substrates, but the role in lactose utilization implies that CCNA_01705 is active on beta-galactosides.
Original annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06439: 3keto-disac_hyd
  • amino acids 43 to 276 (234 residues), 119.2 bits, E=1.2e-38

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_1633)

MetaCyc: 100% identical to 3'-ketolactose hydrolase (Caulobacter vibrioides)
3.2.1.-

Predicted SEED Role

"FIG00482450: hypothetical protein"

MetaCyc Pathways

• lactose degradation II (2/3 steps found)

Sequence Analysis Tools

See A0A0H3C779 at UniProt or InterPro

Protein Sequence (281 amino acids)

>CCNA_01705 3-keto-glycoside 1,2-lyase (Caulobacter crescentus NA1000)
MRGRRAMVWMKPSRGWASFGLVTGLALGLAGASHAEEVQAGPWRSLFDGKTLNGWTAKVA
RHPVGENYRQTFVADQGVIRVSYAGYDRFDNQFGHLFHKTPFSAYRLRFSYRFLTEGGLP
DTPGWARANSGIMFHSQSAESMTVDQPFPVSIEFQLLGKDGDKPRPTGAVCTPGITITID
GAKVKEHCTPPANGPTIANGTWVQAELEVLPSGEITQKINGVVVHRYAGAALDPDDTVAG
GAKPYILARGAQPVTGGYIALQSEGAPLEFKDIEIQELTPR