Protein Info for CCNA_01701 in Caulobacter crescentus NA1000

Updated annotation (from data): 3-keto-glycoside 1,2-lyase
Rationale: Important for the utilization of lactose, salicin, and raffinose. In a conserved cluster with the 3-ketoglycoside pathway starting with lacABC. Distantly related to BT2156, which is a 3-keto-beta-glycoside 1,2-lyase. Lactose and salicin are beta-glycosides but raffinose has two alpha linkages for its hexoses, which suggests that CCNA_01700 acts on alpha-glycosides as well. Note that another lyase (CCNA_01705) is also involved in lactose and raffinose utilization; the two enzymes may be partially redundant. CCNA_01701 has a signal peptide and is expected to be periplasmic
Original annotation: xylose isomerase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 signal peptide" amino acids 1 to 46 (46 residues), see Phobius details PF01261: AP_endonuc_2" amino acids 76 to 306 (231 residues), 52.7 bits, see alignment E=2.5e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_01701)

Predicted SEED Role

"Sugar phosphate isomerases/epimerases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C817 at UniProt or InterPro

Protein Sequence (328 amino acids)

>CCNA_01701 3-keto-glycoside 1,2-lyase (Caulobacter crescentus NA1000)
MSGKVIPMRMTAFDNQSQGLSRRGLLAAGAAALGAGVAGAAGASALPFFQRRNQPVGIQL
YSLGPDLAKELDAQLATVAKIGFRTVELAGYLGRTPAELRALFDRHGLVCPSAHISPKGP
NGFSGDLVKLADELHVIGAKSAIMPIFYIPERMGAADLRQAGVQMTADEWKWNADFLNEK
AAILKKAGILAGYHNHNFEFAPLKDAKGRETTGMDILLKGTDPSLVTFELDAGWVTAAGQ
DPFALLKAYPGRFTQMHVKDVKPSTKPNFELRQDPTEVGSGMIDWKRLLPAAYDAGIRGF
YYEQEPPFAYTRLESARISFDYLAKVVA