Protein Info for CCNA_01700 in Caulobacter crescentus NA1000

Updated annotation (from data): 2-hydroxy-3-keto-glucal / 2-hydroxy-3-keto-galactal transporter
Rationale: Important for utilization of raffinose, lactose, and salicin. In a conserved cluster with the 3-ketoglycoside pathway starting with lacABC. The 3-ketoglycosides are probably cleaved in the periplasm by various lyases (CCNA_01698, CCNA_01705, CCNA_01701) and the 2-hydroxy-3-keto-glucal or -galactal is probably hydrated in the cytoplasm (CCNA_01703), so this transporter probably acts on 2-hydroxy-3-keto-glucal or -galactal.
Original annotation: nucleoside permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 38 to 58 (21 residues), see Phobius details amino acids 70 to 87 (18 residues), see Phobius details amino acids 93 to 118 (26 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 200 to 221 (22 residues), see Phobius details amino acids 239 to 262 (24 residues), see Phobius details amino acids 273 to 292 (20 residues), see Phobius details amino acids 299 to 324 (26 residues), see Phobius details amino acids 336 to 357 (22 residues), see Phobius details amino acids 369 to 390 (22 residues), see Phobius details PF03825: Nuc_H_symport" amino acids 1 to 394 (394 residues), 581.5 bits, see alignment E=1.4e-178 PF12832: MFS_1_like" amino acids 9 to 352 (344 residues), 98.1 bits, see alignment E=8.8e-32 PF07690: MFS_1" amino acids 25 to 347 (323 residues), 70.5 bits, see alignment E=1.9e-23 amino acids 211 to 398 (188 residues), 52.4 bits, see alignment E=6.1e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_1628)

Predicted SEED Role

"FIG00481863: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C775 at UniProt or InterPro

Protein Sequence (413 amino acids)

>CCNA_01700 2-hydroxy-3-keto-glucal / 2-hydroxy-3-keto-galactal transporter (Caulobacter crescentus NA1000)
MGTSFRLFVMMVLQLAIWGAWAPKIFPYMGMLGFAPWQQSLVGSAWGVAALVGIFFSNQF
ADRNFSAERFLAVSHLIGGVALLGTAFSTEFWPFFACYLVFSLVYVPTLSVTNSIAFANL
RDPAAGFGGVRMGGTVGWVLVSWPFVFLLGAQATVEQVRWIFLVAAIVSFVFAGYALTLP
HTPPRKADDAVDKLAWRRAFKLLGAPFVFVLFVVTFIDSVIHNGYFVMADAFLTNRVGIA
GNLSMVVLSLGQVAEIITMLLLGRVLAKLGWKVTMIVGVLGHAARFAVFAYFADSVPVIV
AVQLLHGVCYAFFFATVYIFVDAVFPKDVRSSAQGLFNLLILGVGNVAASFIFPALIGRL
TTDGSVDYTTLFLVPTAMALAAVCLLALFFRPPTRGPVSEADSASSAASSAQA