Protein Info for CCNA_01699 in Caulobacter crescentus NA1000

Annotation: LacI-family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF00356: LacI" amino acids 3 to 48 (46 residues), 66.9 bits, see alignment 2.2e-22 PF00532: Peripla_BP_1" amino acids 59 to 324 (266 residues), 87.6 bits, see alignment E=2.2e-28 PF13407: Peripla_BP_4" amino acids 62 to 311 (250 residues), 45.6 bits, see alignment E=1.3e-15 PF13377: Peripla_BP_3" amino acids 171 to 330 (160 residues), 129.7 bits, see alignment E=2.3e-41

Best Hits

KEGG orthology group: K05499, LacI family transcriptional regulator, repressor for deo operon, udp, cdd, tsx, nupC, and nupG (inferred from 100% identity to ccs:CCNA_01699)

Predicted SEED Role

"Transcriptional (co)regulator CytR" in subsystem CytR regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CA26 at UniProt or InterPro

Protein Sequence (335 amino acids)

>CCNA_01699 LacI-family transcriptional regulator (Caulobacter crescentus NA1000)
MATIQDVAREAGVSTATVSRVFSAPDLVLEATRQKVMEAVQRLGYEPNFAAKSLRTLRTE
KILVTVPDISNPFFSQVIRGVEEAALAAGYSVLLGDTRHEEAREEQYALMFRRKEADGLI
FLGHRLPDVLAEMLAAKGPRTPIVNGCEFRPGLAVSSAHIDNERAAAEVMDHLYGLGHVR
VGVVTGPLASPISSDRLAGVLTAAQRHGRASALRIAIGDFSIESGVRQAGEILDEPGRPT
AIFCFSDEMAMGALEAIRQRGLDCPRDISLVGFDDIRFAQYLHPQLTTVRQPKEQIGHEV
VRLLLDILAGRSTALQNITLPHQLVVRGSTAPPPA