Protein Info for CCNA_01692 in Caulobacter crescentus NA1000

Annotation: GMP synthase GuaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 10 to 198 (189 residues), 211.3 bits, E=8.3e-67
• PF00117: GATase
  • amino acids 11 to 195 (185 residues), 139.9 bits, E=1.6e-44
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 208 to 520 (313 residues), 486.4 bits, E=3.6e-150
• PF02540: NAD_synthase
  • amino acids 214 to 252 (39 residues), 26.5 bits, 6.8e-10
• PF03054: tRNA_Me_trans
  • amino acids 224 to 257 (34 residues), 24.1 bits, see alignment (E = 5.4e-09)
• PF00958: GMP_synt_C
  • amino acids 428 to 519 (92 residues), 149 bits, E=6.8e-48

Best Hits

Swiss-Prot: 100% identical to GUAA_CAUVN: GMP synthase [glutamine-hydrolyzing] (guaA) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 100% identity to ccr:CC_1620)

MetaCyc: 54% identical to GMP synthetase (Escherichia coli K-12 substr. MG1655)
GMP synthase (glutamine-hydrolyzing). [EC: 6.3.5.2]; 6.3.5.2 [EC: 6.3.5.2]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• superpathway of purine nucleotide salvage (10/14 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• L-glutamate and L-glutamine biosynthesis (4/7 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

See B8GVI7 at UniProt or InterPro

Protein Sequence (520 amino acids)

>CCNA_01692 GMP synthase GuaA (Caulobacter crescentus NA1000)
MTQKTDHQRVLIVDFGSQVTQLIARRVREAGVYCEIHPFDKAEAIVDEYAPSAIILSGGP
ASVLEADSPRIGRKLFDLGLPLLAICYGQQLLCDVLSGKVEGGHAGEFGRAELTIGKDSP
MFQGLAGVGGVETVWMSHGDRVTAIPEGFEVIGTSTGAPFAAIANDAKKIYALQFHPEVY
HTVNGPAMYRNFLFNIAGLKGDWTMAAFRQEMVQKIRDQVGDGKVICGLSGGVDSSVAAV
LIHEAIGDQLTCVFVDTGLLRKNEADQVVTLFRDHYNIPLVHVDAGDLFLGELAGVSDPE
TKRKTIGRLFIDVFDKEAAKIEGATFLAQGTLYPDVVESVSARGGPSAVIKSHHNVGGLP
DYMKLKLVEPLRELFKDEVRALGVELGLAPAFVGRHPFPGPGLAIRIPGEITPEKVKVLQ
DADAIYLEEIRNAGLYDQIWQAFAVLLPVKTVGVMGDARTYENVLALRAVTSTDGMTADF
FEFPWPVLGKTATRIINEVRGVNRVVYDVTSKPPGTIEWE