Protein Info for CCNA_01683 in Caulobacter crescentus NA1000

Annotation: acetyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 58 to 76 (19 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 196 to 215 (20 residues), see Phobius details amino acids 227 to 244 (18 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details amino acids 291 to 311 (21 residues), see Phobius details amino acids 323 to 346 (24 residues), see Phobius details amino acids 357 to 378 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 11 to 375 (365 residues), 88.6 bits, see alignment E=2.2e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_1611)

Predicted SEED Role

"FIG00481497: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CA10 at UniProt or InterPro

Protein Sequence (406 amino acids)

>CCNA_01683 acetyltransferase family protein (Caulobacter crescentus NA1000)
MTRVTSLDRRHDLDWIRVGAFFLLILYHTGMFYVPWDWHVKTPHPVEALEPLMQLTNPWR
LTLLFLVSGAATRFMADRTSVGRLTTSRIARLLPPLLFAMFVIVPPQSYYEIVEHVAANP
GAPVAVDSYGVFWRKYATASGNWCDQGECLITPTWNHMWFVAYLLVYSLVLALMLLVLPK
LGDRLQGGLERLLKGAGLLIWPVVFLAATRIFLLPRFEITHDLVEDWYNHAVSFAAFLLG
FGLAKSEVLKARLIEARWTALTLAILCWAGWASYAWIYRADDANPPEALRIVMRCVYATD
QWCAIAAILGFGAKHLSDKGGPVLRYLTLGVFPFYIVHQTLIVVMAHNLAKLGLPQVLEG
AILVAATFAGCFATYEIVRRIPGVRALFGLKGQPAAAPANRPPAVA