Protein Info for CCNA_01682 in Caulobacter crescentus NA1000

Annotation: LytT-family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 55 to 76 (22 residues), see Phobius details amino acids 89 to 112 (24 residues), see Phobius details amino acids 121 to 145 (25 residues), see Phobius details amino acids 175 to 192 (18 residues), see Phobius details PF04397: LytTR" amino acids 214 to 307 (94 residues), 60.2 bits, see alignment E=9.6e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_1610)

Predicted SEED Role

"Response regulator of the LytR/AlgR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8N8 at UniProt or InterPro

Protein Sequence (312 amino acids)

>CCNA_01682 LytT-family transcriptional regulator (Caulobacter crescentus NA1000)
MGASDLKSDAKDLPRGPASGQVQGDQRILAGTSGRGLGTNGGFLGITGEERQWLLRAWLF
GICLISCICLVNILTIQHDSPDLGPIRPVIWEVSSALVTMVIFTIPAAMAVWTSRSRPRW
WIAAPAHLAALLAYSALHVAGFLVLREWAHAAFLNEAYNYGPLSTEFPYEFRKDFLAYLV
ASGIFWLALQRGGQTLDARGPARPATFDIQDGARLIRVAVDKIIAVRSAGNYVEFILADE
RRPLMRSSLTAMQNALAPQGFVRTHKSWLVNKALVTGLRPEGSGDYTIELGALEAPLSRR
FPKALAALREPA