Protein Info for CCNA_01681 in Caulobacter crescentus NA1000

Annotation: RimI-like acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13302: Acetyltransf_3
  • amino acids 3 to 138 (136 residues), 36.4 bits, E=2.1e-12
• PF00583: Acetyltransf_1
  • amino acids 41 to 137 (97 residues), 57.5 bits, E=4.1e-19
• PF13673: Acetyltransf_10
  • amino acids 45 to 144 (100 residues), 40.2 bits, E=7.8e-14
• PF13508: Acetyltransf_7
  • amino acids 50 to 138 (89 residues), 51.3 bits, E=3.1e-17
• PF08445: FR47
  • amino acids 83 to 140 (58 residues), 30.6 bits, E=6.8e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_01681)

Predicted SEED Role

"Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Ribosome biogenesis bacterial (EC 2.3.1.-)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

See A0A0H3C8J2 at UniProt or InterPro

Protein Sequence (168 amino acids)

>CCNA_01681 RimI-like acetyltransferase (Caulobacter crescentus NA1000)
MSITVRRATVADRDAIVAVHRSAAVTPGALARTPEEVTTAFAEAAIAADVCLVAVDADGT
VCGEIHAKRETIALFAHVLGGLTVAVHPDHQGRGVGSRLFESLIAWARSAEPEIVRIELA
AGAGNPGAVRLYERLGFRHEGRQVARGRLPDGRFEDDILMGLLLRPVG