Protein Info for CCNA_01677 in Caulobacter crescentus NA1000

Annotation: carboxypeptidase G2 precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 PF01546: Peptidase_M20" amino acids 98 to 395 (298 residues), 79.7 bits, see alignment E=3.1e-26 PF07687: M20_dimer" amino acids 201 to 300 (100 residues), 69.6 bits, see alignment E=2e-23

Best Hits

KEGG orthology group: K01295, glutamate carboxypeptidase [EC: 3.4.17.11] (inferred from 100% identity to ccs:CCNA_01677)

Predicted SEED Role

"bll3749; probable carboxypeptidase G2 precursor (EC 3.4.17.11)" (EC 3.4.17.11)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.17.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8N3 at UniProt or InterPro

Protein Sequence (414 amino acids)

>CCNA_01677 carboxypeptidase G2 precursor (Caulobacter crescentus NA1000)
MHLTSEDRSVLDRIAQDGGRIVDRAVDWCAINSGSRNLEGLERQRQILLDAAAGLPAAPL
EIPLTPSREIDANGREAEFPHPPSVAVIVRPEAPVQVILTGHYDTVYPENSPFQAVSTRS
DGALHGPGIADMKGGISVMLAALAAFETHPHAGNVGYRVLLSPDEEIGSIASGPILSEFA
RQGHVGLTYEPALADGALAAARKGSGNFHIVIHGRAAHAGRDFAAGRNAIVGAARIAEKL
HALNGLRDGLTVNVARIDGGAPLNMVPDVAVVRFNVRFPEAAAAVWFEAEVARIVSEVDP
DLHAHLHGLITRGAKPFNAAQQQLFGAVKAVGALLGQHITWKPSGGVCEGNNLFASGLPN
VDTLGVRGGDIHSEAEHAWPESFVERAQLSASILMKLASGEIDARAIRAAMENA