Protein Info for CCNA_01670 in Caulobacter crescentus NA1000

Annotation: sulfate transport ATP-binding protein cysA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 TIGR00968: sulfate ABC transporter, ATP-binding protein" amino acids 3 to 242 (240 residues), 364.2 bits, see alignment E=1.4e-113 PF00005: ABC_tran" amino acids 18 to 164 (147 residues), 128.5 bits, see alignment E=4.5e-41 PF13304: AAA_21" amino acids 98 to 198 (101 residues), 29.8 bits, see alignment E=9.1e-11 PF17850: CysA_C_terminal" amino acids 241 to 279 (39 residues), 41.4 bits, see alignment 2.6e-14

Best Hits

Swiss-Prot: 100% identical to CYSA_CAUVC: Sulfate/thiosulfate import ATP-binding protein CysA (cysA) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02045, sulfate transport system ATP-binding protein [EC: 3.6.3.25] (inferred from 100% identity to ccr:CC_1598)

Predicted SEED Role

"Sulfate and thiosulfate import ATP-binding protein CysA (EC 3.6.3.25)" in subsystem Cysteine Biosynthesis (EC 3.6.3.25)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7Y9 at UniProt or InterPro

Protein Sequence (339 amino acids)

>CCNA_01670 sulfate transport ATP-binding protein cysA (Caulobacter crescentus NA1000)
MTIAIRSVEKQFGRYPALNKVDLEIADGELLALLGPSGSGKTTLLRTIAGLEFPDAGQVL
FDGQDVTYASAAARRVGFVFQQYALFKHMTVAKNIAFGLDVRKGKDKPSKAEIARRVEEL
LKLVELEGLGGRYPSQLSGGQRQRVALSRALAVQPSVLLLDEPFGALDATVRKSLRRELR
RVHDATGVTTIFVTHDQEEALELADRVAILNNGRIEQIGTPDQVHDAPETAFVCGFVGEA
NRFDGQVSGGRFKAGALTVPASALKDGAATAYVRPHDFALDEAGFEVLIERAQVQGALTA
VTALTSDGRRLEISASRADADRFTGAVKIVARKAHVYAA