Protein Info for CCNA_01669 in Caulobacter crescentus NA1000

Annotation: sulfate transport system permease protein cysW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 68 to 91 (24 residues), see Phobius details amino acids 101 to 128 (28 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 203 to 228 (26 residues), see Phobius details amino acids 248 to 271 (24 residues), see Phobius details TIGR02140: sulfate ABC transporter, permease protein CysW" amino acids 19 to 274 (256 residues), 394.1 bits, see alignment E=3.1e-122 TIGR00969: sulfate ABC transporter, permease protein" amino acids 19 to 273 (255 residues), 317.7 bits, see alignment E=6.8e-99 PF00528: BPD_transp_1" amino acids 83 to 280 (198 residues), 37.3 bits, see alignment E=1.3e-13

Best Hits

Swiss-Prot: 57% identical to CYSW_SYNY3: Sulfate transport system permease protein CysW (cysW) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02047, sulfate transport system permease protein (inferred from 100% identity to ccr:CC_1597)

MetaCyc: 52% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysW (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysW" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C755 at UniProt or InterPro

Protein Sequence (285 amino acids)

>CCNA_01669 sulfate transport system permease protein cysW (Caulobacter crescentus NA1000)
MGAASSKARGATDDPAWAKILLIGAVFVFLALVLILPLVAVFAEALRKGLDAAILAARQP
DALAAVKLTLLTAAIAVPFNAVFGLCAAWAIAKHDFRGKALLITLIDLPFSVSPVVAGLI
YVLIFGLQGWFGEWLLDNDIRIIFAVPGIVLATVFVTFPFVARELIPLMQEQGTSEEEAA
ISMGASGLYTFWRVTAPNVRWGLLYGVLLCNARAMGEFGAVSVVSGHIRGLTNTMPLHVE
ILYNEYDFVGAFAVAALLCLLAVVTLVLKTALEIAQPDVRGRRGH