Protein Info for CCNA_01650 in Caulobacter crescentus NA1000

Annotation: copper/zinc superoxide dismutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00080: Sod_Cu
  • amino acids 40 to 173 (134 residues), 130.8 bits, E=2.3e-42

Best Hits

Swiss-Prot: 100% identical to SODC_CAUVC: Superoxide dismutase [Cu-Zn] (sodC) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K04565, Cu/Zn superoxide dismutase [EC: 1.15.1.1] (inferred from 100% identity to ccr:CC_1579)

Predicted SEED Role

"Superoxide dismutase [Cu-Zn] precursor (EC 1.15.1.1)" in subsystem Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

• reactive oxygen species degradation (4/4 steps found)
• superoxide radicals degradation (2/2 steps found)
• ethene biosynthesis III (microbes) (5/7 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.15.1.1

Use Curated BLAST to search for 1.15.1.1

Sequence Analysis Tools

See A0A0H3C8G5 at UniProt or InterPro

Protein Sequence (174 amino acids)

>CCNA_01650 copper/zinc superoxide dismutase (Caulobacter crescentus NA1000)
MIRLSAAAALGLAAALAASPALAQTSATAVVKAGDGKDAGAVTVTEAPHGVLLKLELKGL
TPGWHAAHFHEKGDCGTPDFKSAGAHVHTAATTVHGLLNPDANDSGDLPNIFAAADGAAT
AEIYSPLVSLKGAGGRPALLDADGSSIVVHANPDDHKTQPIGGAGARVACGVIK