Protein Info for CCNA_01649 in Caulobacter crescentus NA1000

Annotation: transporter, drug/metabolite exporter family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 133 to 151 (19 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details amino acids 223 to 246 (24 residues), see Phobius details amino acids 258 to 275 (18 residues), see Phobius details amino acids 281 to 298 (18 residues), see Phobius details PF00892: EamA" amino acids 25 to 150 (126 residues), 42.1 bits, see alignment E=5.2e-15 amino acids 160 to 297 (138 residues), 65.3 bits, see alignment E=3.5e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_01649)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7X6 at UniProt or InterPro

Protein Sequence (313 amino acids)

>CCNA_01649 transporter, drug/metabolite exporter family (Caulobacter crescentus NA1000)
MTGLAGSGPSGAMSGKSSPLSVLEYLAIFAIIMTWGINNAAAKVATAYLPPMTVGGLRFL
AALVFLFPFIRPPFPEPKKLAAIVLLTGPIHFGLVYVGFGMGQSLSPLVVASQLWIPFTA
LVAWKLLGETMRLPAVLGLIVAFVGVAWMTLDPHTSGDLPAIVLIVLASACWAVATILVR
MTPGAKPLKVQAVTALFAAPSLLAMSFAFETQVVERVMTAPPIAWACVIFAGVVSTIGAS
ALLFWLVQRREAGRVTPYFLLTPLVSCTLGVAFLGDKLTPQLLIGGAATMVGVALVAMTE
KRARAEEALAETA