Protein Info for CCNA_01647 in Caulobacter crescentus NA1000

Annotation: 8-amino-7-oxononanoate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 TIGR00858: 8-amino-7-oxononanoate synthase" amino acids 21 to 376 (356 residues), 461.7 bits, see alignment E=6.8e-143 PF00155: Aminotran_1_2" amino acids 41 to 376 (336 residues), 189.3 bits, see alignment E=1.8e-59 PF01041: DegT_DnrJ_EryC1" amino acids 85 to 224 (140 residues), 30.4 bits, see alignment E=3.7e-11

Best Hits

Swiss-Prot: 100% identical to BIOF_CAUVC: Putative 8-amino-7-oxononanoate synthase (bioF) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K00652, 8-amino-7-oxononanoate synthase [EC: 2.3.1.47] (inferred from 100% identity to ccs:CCNA_01647)

MetaCyc: 39% identical to BioF (Lysinibacillus sphaericus)
8-amino-7-oxononanoate synthase. [EC: 2.3.1.47]

Predicted SEED Role

"8-amino-7-oxononanoate synthase (EC 2.3.1.47)" in subsystem Biotin biosynthesis (EC 2.3.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GVE2 at UniProt or InterPro

Protein Sequence (384 amino acids)

>CCNA_01647 8-amino-7-oxononanoate synthase (Caulobacter crescentus NA1000)
MRSLDAFAGQKLAALDAQSLRRRLSPTRRHDGAVVERDGKRMISFSCNDYLNLSQHHLVR
AAAAEAALNYGAGAAASRLVTGDHPLLSDLEKRLAHLKGTEAACVFGSGYLANTGVIPTL
VGPGDVILIDALAHACIWAGAQLSGAKVVKFAHNDPADLERLLLAERGAARHALVATDGV
FSMDGDIAPLDALSELCQRHDAWLLSDDAHGVGVLAEGRGSGALFPTAKIPLQMGTLSKA
LGSYGGYLCGSQAVVDLLKTRARTLVYATGLPPASAAAALASLDLIAANPTMTEVPLAKA
RLFTRRLGLPEACSPIVPVVLGSAESALAASTELQNQGFLVVAIRPPTVPDGTARLRIAF
SAAHEDADIIRLADAIAKLRETAS