Protein Info for CCNA_01633 in Caulobacter crescentus NA1000

Annotation: GTP-binding protein era

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 TIGR00436: GTP-binding protein Era" amino acids 11 to 295 (285 residues), 213.2 bits, see alignment E=4.4e-67 PF01926: MMR_HSR1" amino acids 13 to 141 (129 residues), 77 bits, see alignment E=5.1e-25 TIGR00231: small GTP-binding protein domain" amino acids 14 to 182 (169 residues), 62.6 bits, see alignment E=3.9e-21 PF02421: FeoB_N" amino acids 14 to 100 (87 residues), 32.1 bits, see alignment E=3.2e-11 PF07650: KH_2" amino acids 224 to 301 (78 residues), 66.7 bits, see alignment E=5.1e-22

Best Hits

Swiss-Prot: 100% identical to ERA_CAUVN: GTPase Era (era) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K03595, GTP-binding protein Era (inferred from 100% identity to ccr:CC_1562)

Predicted SEED Role

"GTP-binding protein Era" in subsystem Bacterial Cell Division or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H630 at UniProt or InterPro

Protein Sequence (316 amino acids)

>CCNA_01633 GTP-binding protein era (Caulobacter crescentus NA1000)
MTDTTSKTRAGFAAIIGAPNAGKSTLVNRMVGAKVSIVTQKVQTTRFPVRGVAIEGDTQI
VLVDTPGIFSPRRRLDRAMVRAAWAGSEEAEATVHLVDVQAELASRADKATPGEYRSAQD
VQTIIEGLKAADRKVILALNKIDGIKRDTLLAVAKDFFDTGVYSDVFMISASTGAGVEDL
TAKLVSMMPEGPWLYPEDQTADLPARLLAAEITREKVYLRVHEELPYAATVETTAFEERK
DGSVRIEQTILVEREGQRVIVIGKGGQTLKWIGQASREELCDILDRKVHLFLHVKVKENW
AEERGLFSDIGLDFDV