Protein Info for CCNA_01629 in Caulobacter crescentus NA1000

Annotation: signal peptidase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 23 to 42 (20 residues), see Phobius details PF10502: Peptidase_S26" amino acids 21 to 252 (232 residues), 175 bits, see alignment E=6.3e-56 TIGR02227: signal peptidase I" amino acids 24 to 212 (189 residues), 143.5 bits, see alignment E=2.7e-46

Best Hits

KEGG orthology group: K03100, signal peptidase I [EC: 3.4.21.89] (inferred from 100% identity to ccs:CCNA_01629)

Predicted SEED Role

"Signal peptidase I (EC 3.4.21.89)" in subsystem Signal peptidase (EC 3.4.21.89)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.89

Use Curated BLAST to search for 3.4.21.89

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8K1 at UniProt or InterPro

Protein Sequence (281 amino acids)

>CCNA_01629 signal peptidase I (Caulobacter crescentus NA1000)
MTDAADDFTPPEEKGVVAELIEIVKTVAYALGIALVLRVLLFQPFTIPSASMEPNLYQGD
YIIVSKFSYGWSKHSIPFSPPIIKGRIFDRAPKRGDIVVFKLPRDNRTDYIKRLIGMPGD
KVQIRGGEVYINGKALPRKAQAPALVDTGYGFTQQVQRFQETSPEGRPYNIQDFGPDSRG
DNTGIYTVPAGCYFFMGDNRDNSADSRFDPGVSPYKESACKWDYELDQYIGDEIGVGFVP
AENLVGRAQIILLSWNAEASLFKPWTWFLDARPSRFFHVLK