Protein Info for CCNA_01610 in Caulobacter crescentus NA1000

Annotation: 2-isopropylmalate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 524 PF00682: HMGL-like" amino acids 15 to 283 (269 residues), 309 bits, see alignment E=3e-96 TIGR00973: 2-isopropylmalate synthase" amino acids 15 to 505 (491 residues), 692.9 bits, see alignment E=1e-212 PF08502: LeuA_dimer" amino acids 380 to 507 (128 residues), 127.1 bits, see alignment E=4.3e-41

Best Hits

Swiss-Prot: 100% identical to LEU1_CAUVC: 2-isopropylmalate synthase (leuA) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K01649, 2-isopropylmalate synthase [EC: 2.3.3.13] (inferred from 100% identity to ccr:CC_1541)

Predicted SEED Role

"2-isopropylmalate synthase (EC 2.3.3.13)" in subsystem Branched-Chain Amino Acid Biosynthesis or Leucine Biosynthesis (EC 2.3.3.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.3.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H607 at UniProt or InterPro

Protein Sequence (524 amino acids)

>CCNA_01610 2-isopropylmalate synthase (Caulobacter crescentus NA1000)
MTSVPAGAISKRDNVVVFDTTMRDGEQSPGASMSLEEKLELAKILEEMGVDVIEAGFPIA
SNGDFEAVRQIAELITESTVCGLARAAAGDIDRCAEAVRRAKRGRIHTFISTSPVHMKYK
LQMEPDAVLEAITRSVSHARNLVGDVEWSAEDATRTERDFLKRCVEAAIKAGATTINLPD
TVGYSYPSEYGELFRDVITSVPGADKAIFSAHCHNDLGLAVANSIAAIEGGARQVEVAIN
GIGERAGNAALEEIVMALRVRGDHLPYGTSVDPVHITRASRYVSAITGFPVQFNKAIVGK
NAFAHESGIHQDGMLKNAETYEIMKPEDVGQGATNLVMGKHSGRHAFREKLKALGYELGQ
NALNDAFGRFKELADKKKHVFDDDIVALVDDALARGSEKIRVSRLRVVAGTDGQSAELTL
DIDGVASTAEATGDGPVDAVFNAIHKIVPHSAALRLFQVHAVTEGTDAQAQVSVRLEEDG
RIATGAAADTDTLTASAKAYVNALNNLFARKEKSRPEAAIASGF