Protein Info for CCNA_01607 in Caulobacter crescentus NA1000

Annotation: SNARE associated protein family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 60 to 90 (31 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details PF09335: VTT_dom" amino acids 77 to 193 (117 residues), 99.3 bits, see alignment E=1.1e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_01607)

Predicted SEED Role

"FIG00481802: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8D5 at UniProt or InterPro

Protein Sequence (239 amino acids)

>CCNA_01607 SNARE associated protein family (Caulobacter crescentus NA1000)
MIRRFIDFITNMDARAWRMVAVSFVLFGGVGLVFLFGAQLLGLNGEATVEHWLLAASGPW
ALPVAVAVFAIMAFLGVPQFVLIAAAVVAFGPWTGFAYSWIGTLVSSLVGFWLGRAYGAR
ILRDFAGESVNKFMRMIGKNGFMASLIVRLVPSAPFIVVNMAAGVTPMRLRDFAAGTAIG
IVPKIALTAFAGNSIVQAMRGGGKQHIAMIALAIVIWLGMGLLSRAWLTRREAGEAGEG