Protein Info for CCNA_01580 in Caulobacter crescentus NA1000

Annotation: M15 superfamily membrane peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF05951: Peptidase_M15_2" amino acids 64 to 213 (150 residues), 237.5 bits, see alignment E=5.1e-75 PF08291: Peptidase_M15_3" amino acids 120 to 206 (87 residues), 41.3 bits, see alignment E=1.6e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_1512)

Predicted SEED Role

"FIG001587: exported protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7S6 at UniProt or InterPro

Protein Sequence (216 amino acids)

>CCNA_01580 M15 superfamily membrane peptidase (Caulobacter crescentus NA1000)
MHRRKLLQWGLGAIGAGLLPLAARADDDIIGALLEGKMPQATPVPPPTTVAATVASIDPP
ALKPAVDPRWVHLHNVHTGEKLEAVYWENGDYVPDAVSALDKVLRDYRNDEVHPIDRGLY
DLLDQIARKTQSKGPFQVISGYRSPATNRLLSKRSGEVAKKSLHMDGKAMDIFLEDVELK
HVRAAALDLSVGGVGYYPTSNFVHVDVGPVRKWTGT