Protein Info for CCNA_01574 in Caulobacter crescentus NA1000
Annotation: arsenic resistance protein arsH
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 75% identical to ARREH_RHIME: NADPH-dependent FMN reductase ArsH (arsH) from Rhizobium meliloti (strain 1021)
KEGG orthology group: K11811, arsenical resistance protein ArsH (inferred from 100% identity to ccr:CC_1506)MetaCyc: 74% identical to ArsH (Pseudomonas putida KT2440)
Predicted SEED Role
"Arsenic resistance protein ArsH" in subsystem Arsenic resistance
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0H3C6Z4 at UniProt or InterPro
Protein Sequence (244 amino acids)
>CCNA_01574 arsenic resistance protein arsH (Caulobacter crescentus NA1000) MSEFPALDPNFLAKIDEARLEVDARAAHSPRILLLYGSLRERSFSRLLVEEAARILQALG CETRIFDPRDLPLPDATGPDHPKVQELRALCQWSEGQVWCSPERHGAITGIIKAQIDWIP LEIGSVRPTQGKTLAVMQVSGGSQSFNAVNTLRLLGRWMRMITIPNQSSVAMAFREFDDN DRMLPSSYYDRLVDVMEELVKFTLLTRDRADYLVDRYSERKAQGRIPEHVALAAEAMKHE TAPR